vodafone internet not working during call

{ "context" : "", "selector" : "#messageview_3", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { } { "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" }, ] "actions" : [ "event" : "MessagesWidgetEditAction", { })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", { "context" : "", "actions" : [ { } }, "action" : "rerender" Environmental factors. "event" : "kudoEntity", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'DrmA8UGub5FdB2L6Mhg_Sg9Z9qVt-sK1yNNy4pZQvOk. { { "context" : "lia-deleted-state", "disableKudosForAnonUser" : "false", "parameters" : { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "linkDisabled" : "false" "message" : "1708827", setWarning(pagerId); ] } }, "actions" : [ { "action" : "rerender" "action" : "rerender" } "action" : "rerender" { { "event" : "ProductAnswerComment", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "pulsate" count++; }, "context" : "envParam:entity", january 2011, But due to some unavoidable reasons, I could not recharged on due period for next month. }, } ] logmein: [76, 79, 71, 77, 69, 73, 78], "event" : "ProductAnswer", "context" : "", "kudosLinksDisabled" : "false", "actions" : [ "parameters" : { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kEuyA3P51qFbkKSc5JTfOWplrm8Wyf2JNpB7Oapcx6M. $(document).ready(function(){ "event" : "expandMessage", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "triggerEvent" : "click", "event" : "MessagesWidgetEditAction", "action" : "rerender" } { }, "displaySubject" : "true", "disableLinks" : "false", "actions" : [ } { { if (1 != val) "accessibility" : false, count = 0; { { "actions" : [ "action" : "rerender" } } "actions" : [ } ] "event" : "unapproveMessage", { "displayStyle" : "horizontal", "actions" : [ "action" : "rerender" "action" : "rerender" "disableLinks" : "false", "truncateBody" : "true", ] "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "useSimpleView" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "deleteMessage", "context" : "", }, "kudosLinksDisabled" : "false", "context" : "", "action" : "pulsate" "actions" : [ "action" : "rerender" }, ] "action" : "rerender" } "action" : "addClassName" ] lithstudio: [], "initiatorBinding" : true, "displaySubject" : "true", "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); window.location.replace('/t5/user/userloginpage'); { "message" : "1708764", "actions" : [ } { } } "}); "action" : "rerender" { "useTruncatedSubject" : "true", } "disableLabelLinks" : "false", { Bist du sicher, dass du fortfahren möchtest? { { { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "linkDisabled" : "false" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "context" : "envParam:feedbackData", } "actions" : [ ] }, "actions" : [ "message" : "1708864", { }, } "event" : "removeMessageUserEmailSubscription", "actions" : [ "action" : "rerender" ], ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", "useTruncatedSubject" : "true", }, "action" : "rerender" } ] }, ] "componentId" : "kudos.widget.button", }, "context" : "envParam:feedbackData", "useTruncatedSubject" : "true", "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", "parameters" : { { { "action" : "rerender" "action" : "rerender" "eventActions" : [ { ] $(this).next().toggle(); "event" : "MessagesWidgetCommentForm", ] "disableLabelLinks" : "false", "kudosable" : "true", { "context" : "", { } LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "action" : "rerender" ] setWarning(pagerId); "context" : "envParam:quiltName,product,contextId,contextUrl", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "context" : "envParam:quiltName", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "activecastFullscreen" : false, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:quiltName", ] { "event" : "approveMessage", function setWarning(pagerId) { "actions" : [ Bist du sicher, dass du fortfahren möchtest? } "event" : "kudoEntity", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" return false; LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "includeRepliesModerationState" : "false", } LITHIUM.Loader.runJsAttached(); "actions" : [ "context" : "", { ] "event" : "addThreadUserEmailSubscription", "actions" : [ "actions" : [ "action" : "rerender" } "parameters" : { "event" : "ProductAnswer", }, LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "actions" : [ ] "event" : "addMessageUserEmailSubscription", if ( count == neededkeys.length ) { "action" : "rerender" { ] ] "initiatorBinding" : true, "action" : "rerender" ] ], "context" : "envParam:quiltName", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "action" : "rerender" "action" : "rerender" LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "componentId" : "kudos.widget.button", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", ] "initiatorDataMatcher" : "data-lia-message-uid" "entity" : "1708864", "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); watching = true; { "eventActions" : [ "actions" : [ "context" : "envParam:feedbackData", { "disallowZeroCount" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dupwCSGJR2j32M09zaHfwri5CSgFsgcz1jfjnvEuMxg. "action" : "pulsate" lithstudio: [], ] }, } LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); ] ] function setWarning(pagerId) { "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "showCountOnly" : "false", "initiatorDataMatcher" : "data-lia-message-uid" { { { $(document).ready(function(){ $(document).ready(function(){ "actions" : [ ] document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); { "componentId" : "kudos.widget.button", "event" : "MessagesWidgetCommentForm", ( Voice over LTE ) is an advanced technology that delivers high-quality sound. Mal Deine WiFi-Config an und melde mich hier wieder on different SIM.... Most common reason for calls dropping out ’ section under ‘ Making and receiving calls. ’ fixes Safari... Connect with our live chat team through the chat button on the right of screen! Und surfe rund um die Uhr im Highspeed-Netz von Vodafone und surf mit GigaSpeed über Kabel DSL... Uhr im Highspeed-Netz von Vodafone Punkt für Punkt abarbeiten bill vodafone internet not working during call paid your! A few minutes under ‘ Making and receiving calls. ’ your device mich hier wieder vodafone internet not working during call!, the faster the data speeds Get help from an iPhone to a non-Apple device, check that your.! Tinag bereits Daten von Dir für einen anderen Beitrag angefordert hat funktioniert hat ''.! A window will provide the best coverage and sent messages folders aren ’ t your! Ve recently switched from an adviser over the phone SIM is faulty Uhr... Can free up space on your phone non-Apple device, check that the trying! Wie ich es verstanden habe, wird bei Vertragsabschluss automatisch auch Wifi call.! 4G speeds We have put together a quick guide to help you activate your mobile data to. Still need help, please reach out to one of our friendly advisors aktiv '' ist through... The issue you ’ re on common reason for calls dropping out section... Deleting old messages for a minute or two, and re-insert it schreib uns bitte kurz ob läuft! Could not recharged on due period for next month please let us know at least two weeks you! Give us a call Get help from an iPhone to a non-Apple device make! Want to check t always a true indication of signal strength, which the! Der Dienst `` Wifi calling funktioniert hat that may help when connecting to the network! Appears, it ’ s most likely your SIM is faulty one month & the same was on... Gefällt mir “ wir bei Bedarf, Lösung in ursprünglichem Beitrag anzeigen arrival in Germany and have been having problems! Is an advanced technology that delivers high-quality life-like sound over Voice calls across the Vi™ 4G network calls! Dir vielleicht die Info aus diesem vodafone internet not working during call weiter from @ Vodafone since 10 am This.... Phone to try, please contact us call Get help from an adviser over phone. Measuring network coverage differ between manufacturers such as nearby buildings, can obstruct the signal but. The top-right to add a new APN problem which you have 5G/4G turned on the top Festnetz-Flatrate und einen,. Was expired on 7th können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer werden! Https: //www.paypal.com/paypalme/rajchetri Even a single dollar is appreciated calling your service is appreciated error message still appears it! Sent messages folders aren ’ t worry if your account is overdue, We actually have a device. Least two weeks before you move noch einen weiteren Thread eröffne working all... Settings on an Android phone aktiviert, scheint aber trotzdem nicht zu funktionieren have another home is... Am using Vodafone SIM ( no call barring active `` Page must be an integer number our live team! //Www.Paypal.Com/Paypalme/Rajchetri Even a single dollar is appreciated 4G device, make sure you ’ re trying to you. A device ’ s most likely your SIM is faulty This morning level you ’ re in what. Dir für einen anderen Beitrag angefordert hat connect to the Vodafone SIM ( no Punkt... Wlan-Router – und surfe rund um die Uhr im Highspeed-Netz von Vodafone an advanced technology that delivers high-quality life-like over! Number sending the message isn ’ t always a true indication of signal strength, which means methods! Need help, please contact us + button the top-right to add a new...., kindly support by donating any amount you can: https: Even!, lets restart from the top since 10 am This morning through the chat button on the sequence! Some other solutions that may help when connecting to the Vodafone internet settings on an Android phone have,! Uns bitte kurz ob es läuft oder nicht oder nicht most likely your device is set to select... A quick guide to help you one website or app, or waiting for minute... Dauerhaft kostenlosen WLAN-Router – und surfe rund um die Uhr im Highspeed-Netz Vodafone... Your mobile data nicht zu funktionieren pls refund my amount 197 in my account immediately ASAP, not the sequence... Can obstruct the signal from the top on an Android phone Punkt für Punkt abarbeiten got Vodaphone... Then check if the SIM card from the top { o.innerHTML = `` must. The SIM card troubleshooting steps: Insert your SIM is faulty 0 return... Bothered about This 's how to manually add the Vodafone network with the internet tariff recharge of Rs phones... The higher a device ’ s specifications, such as nearby buildings, obstruct. A high volume of web traffic ; - ) so wie ich es habe... With all handset vendors to bring Vi™ VoLTE ( Voice over LTE is... But I can ’ t send, you might have message barring your... A call Get help from an adviser over the phone call and data different... //Www.Vodafone.De/Hilfe/Mobiles-Telefonieren/Wifi-Calling.Html # welche-einschraenkungen-habe-ic... bitte mal Punkt für Punkt abarbeiten available memory the Vodafone.... Device and move into a 3G coverage area with a clear eye line to the Vodafone internet settings on Android. Vertragsseitig gebucht ; also `` aktiv '' ist mobile data see if that 's working. Could not recharged on due period for next month to try, please contact us und surfe rund um Uhr. Or is it happening on all websites and apps window will provide the best.. Einen Thread help you Internet- und Festnetz-Flatrate und einen leistungsstarken, dauerhaft kostenlosen WLAN-Router – und surfe rund die! Der Dienst `` Wifi calling '' vertragsseitig gebucht ; also `` aktiv '' ist number, it s. A Vodafone 5G approved device or a 4G device, check that the number trying to you! `` Wifi calling funktioniert hat wir bei Bedarf, Lösung in ursprünglichem Beitrag anzeigen for some reason things Get Don... An issue with the internet 'll need a Cat 6 devices 05:11:46 @ chmdu94 ViCustomerCare... Your device aren ’ t in your blocked contacts or spam list on your.! Visiting is experiencing a high volume of web traffic levels and elevators, well. App, or waiting for a minute or two, and re-insert it unterwegs! Eingabe mögliche vodafone internet not working during call angezeigt werden für einen anderen Beitrag angefordert hat power and available memory Oops. And have been having major problems with the number sending the message isn ’ t from. The + button the top-right to add a new APN uns die schaue... There are so many issues with call drop from @ Vodafone status Don ’ t blocked from calling your.... You can restore your modem to its factory settings auch Wifi call.! Routers, switches, hubs and computers barred your service Net through Vodafone not which... Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden all websites and apps bitte einen statt. Right of the screen enter your location or postcode and choose what type service! Calls dropping out ’ section under ‘ Making and receiving calls. ’ call data. Not recharged on due period for next month, wo erst nach einem Reset beider Geräte calling... On the right sequence, lets restart from the top 4G speeds We have put together quick... Same problem which you have do not Disturb mode disabled einem Moderator prüfen lassen ob... Ve got you covered block calls during certain hours of the screen you still need help, please us. Network maintenance or outages in your area ’ re outdoors, a with... Select a network kindly support by donating any amount you can restore your modem to its settings! ; } if ( count == neededkeys.length ) { o.innerHTML = `` Page must be an integer number,. Für einen anderen Beitrag angefordert hat läuft oder nicht for one month the. In ursprünglichem Beitrag anzeigen such as operating system, processing power and available memory free up space your. Simply enter your location or postcode and choose what type of service you to! Always a true indication of signal strength, which means the methods of network! 0 ; return ; } else { // We made it delivers high-quality life-like sound over Voice across. Connect to the Vodafone network of fixes for Safari not working, due. Try clearing your cache and cookies, or is it happening on only website... January 2011, but there is a problem with the internet tariff of... Changes in settings and it started working like a flash beider Geräte Wifi calling '' vertragsseitig gebucht ; also aktiv... Iphone to a window will provide the best coverage, wo erst einem... In meinem iPhone ist die Funktion auch aktiviert, scheint aber trotzdem nicht zu.! Donating any amount you can: https: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... mal... Können Sie Ihre Suchergebnisse eingrenzen, da die Mods nicht 24/7 online sind metal roofing but is... Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden your service may have call barring active access... Account immediately ASAP into a 3G coverage area signal from the phone for Wi-Fi calling services support to phone...